PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.C00746.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family ZF-HD
Protein Properties Length: 273aa    MW: 29275.8 Da    PI: 9.0407
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.C00746.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.21.4e-3158112358
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                       ++ Y+eClkNhAa++Gg+++DGCgEfmps g++gt +alkCaACgCHRnFHR+e++
  Migut.C00746.1.p  58 RISYRECLKNHAANIGGNVTDGCGEFMPS-GDDGTLEALKCAACGCHRNFHRKEHH 112
                       689*************************9.999********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047703.6E-2959111IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-2161110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.1E-2961110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152326.5461110IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466892.46E-15189260IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.3E-27196262IPR009057Homeodomain-like
TIGRFAMsTIGR015657.1E-27203259IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MTSLPGEEKD AMRMSSSLGG YNINSVENNT VTPVEKPRIT DPFSGGSKPK PGGANHPRIS  60
YRECLKNHAA NIGGNVTDGC GEFMPSGDDG TLEALKCAAC GCHRNFHRKE HHHPHGGGES  120
ATAGAMVHPL QLPPPLPSPS MSQHRAGGGA HHWSAMVQPV KMAYGSGGGG AGSAGTDSSS  180
EELNFNTYHS SGVAPPPPQF VTKKRHRTKF TTEQKGKMLE LAEKLGWRIP REDDAEVQRF  240
CAEFGVKRQV FKVWMHNNKS SSSSKKNPQE LI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A4e-242032641778ZF-HD homeobox family protein
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012846086.10.0PREDICTED: zinc-finger homeodomain protein 5
TrEMBLA0A022RZP31e-155A0A022RZP3_ERYGU; Uncharacterized protein
STRINGSolyc04g080490.2.15e-83(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.22e-50homeobox protein 31